Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G170900_circ_g.1 |
| ID in PlantcircBase | gma_circ_007444 |
| Alias | gma-circRNA2330 |
| Organism | Glycine max |
| Position | chr17: 16112038-16112485 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_17G170900 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH04575:2 KRH04570:2 KRH04574:2 KRH04576:2 KRH04571:2 KRH04572:2 KRH04569:2 KRH04573:2 KRH04568:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.351699126 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16112408-16112457(-) |
| Potential amino acid sequence |
MLKELWVTIHVYLLKGNPLTMEVGSVTWPLVQMGCFKPKEGQLPQNKPGPQSVAAEHASRILNW LVTVSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |