Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0679000_circ_g.4 |
| ID in PlantcircBase | osa_circ_003232 |
| Alias | Os_ciR6003 |
| Organism | Oryza sativa |
| Position | chr1: 27945843-27945992 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0679000 |
| Parent gene annotation |
RNA polymerase III Rpc82, C -terminal domain containing protein. (Os01t0679000-01);Hypothetical conserved gene. (Os01t0679000-02 ) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0679000-02:1 Os01t0679000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.272218778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27945961-27945989(+) 27945924-27945970(-) 27945908-27945966(-) |
| Potential amino acid sequence |
MVNYIAELLLERILSGTGTGNTQYFVWRVKNTFREQFIDNLCHAALNLRQMVNYIAELLLERIL SGTGTGNTQYFVWRVKNTFREQFIDNLCHAALNLRQMVNYIAELLLERILSGTGTGNTQYFVWR VKNTFREQFIDNLCHAALNLRQMVNYIAELLLE(+) MNCSRNVFFTLHTKYCVFPVPVPERILSSRSSAM*(-) MYFSLSIQNIVCSLFLFQKGFSRVGVQLCN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |