Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G49650_circ_g.7 |
ID in PlantcircBase | ath_circ_026745 |
Alias | At_ciR4566 |
Organism | Arabidpsis thaliana |
Position | chr3: 18408998-18409272 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
Parent gene | AT3G49650 |
Parent gene annotation |
Kinesin-like protein KIN-8B |
Parent gene strand | - |
Alternative splicing | AT3G49650_circ_g.4 AT3G49650_circ_g.5 AT3G49650_circ_g.6 |
Support reads | 3/2 |
Tissues | leaf/aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G49650.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.334654754 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18409249-18409000(-) |
Potential amino acid sequence |
MEKERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNKVAVKCRPLM EKERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNKVAVKCRPLME KERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNKVAVKCRPLMEK ERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |