Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G49650_circ_g.7 |
| ID in PlantcircBase | ath_circ_026745 |
| Alias | At_ciR4566 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 18408998-18409272 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
| Parent gene | AT3G49650 |
| Parent gene annotation |
Kinesin-like protein KIN-8B |
| Parent gene strand | - |
| Alternative splicing | AT3G49650_circ_g.4 AT3G49650_circ_g.5 AT3G49650_circ_g.6 |
| Support reads | 3/2 |
| Tissues | leaf/aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G49650.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.334654754 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18409249-18409000(-) |
| Potential amino acid sequence |
MEKERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNKVAVKCRPLM EKERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNKVAVKCRPLME KERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNKVAVKCRPLMEK ERGRDIVRVNNSKEVVVLDPDLSKDYLDRIQNRTKEKKYCFDHAFGPESTNK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |