Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0818400_circ_g.2 |
| ID in PlantcircBase | osa_circ_022461 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 34347769-34347895 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0818400 |
| Parent gene annotation |
Similar to 40S ribosomal protein S23 (S12). (Os03t0818400-01);Si milar to 40S ribosomal protein S23 (S12). (Os03t0818400-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0818400_circ_g.1 Os03g0818400_circ_g.3 Os03g0818400_circ_g.4 |
| Support reads | 4 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0818400-02:1 Os03t0818400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.611531693 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34347891-34347779(+) |
| Potential amino acid sequence |
MPIFLDEVQATIVRHKGSYLLPILHQLNTSTLTDSRVWLLSFNANFPR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |