Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0818400_circ_g.2 |
ID in PlantcircBase | osa_circ_022461 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 34347769-34347895 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os03g0818400 |
Parent gene annotation |
Similar to 40S ribosomal protein S23 (S12). (Os03t0818400-01);Si milar to 40S ribosomal protein S23 (S12). (Os03t0818400-02) |
Parent gene strand | - |
Alternative splicing | Os03g0818400_circ_g.1 Os03g0818400_circ_g.3 Os03g0818400_circ_g.4 |
Support reads | 4 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0818400-02:1 Os03t0818400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.611531693 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34347891-34347779(+) |
Potential amino acid sequence |
MPIFLDEVQATIVRHKGSYLLPILHQLNTSTLTDSRVWLLSFNANFPR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |