Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_04G256100_circ_g.1 |
| ID in PlantcircBase | gma_circ_001018 |
| Alias | Gm04circRNA1768 |
| Organism | Glycine max |
| Position | chr4: 52233576-52234368 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_04G256100 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH64811:4 KRH64808:4 KRH64810:4 KRH64809:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_028385 |
| PMCS | 0.535362926 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
52233920-52234354(-) |
| Potential amino acid sequence |
MRPRARDKKLVEEWAVPLKSVEDIYERFRLYCLGKLRSNPWSELDGLQPETKIINEQLEKINTK GFLTINSQPAVNGEKSDSPTVEPWPN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |