Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | GLYMA_04G256100_circ_g.1 |
ID in PlantcircBase | gma_circ_001018 |
Alias | Gm04circRNA1768 |
Organism | Glycine max |
Position | chr4: 52233576-52234368 JBrowse» |
Reference genome | v2.0.38 |
Type | e-circRNA |
Identification method | Tophat, CIRI |
Parent gene | GLYMA_04G256100 |
Parent gene annotation |
hypothetical protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | stem |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | KRH64811:4 KRH64808:4 KRH64810:4 KRH64809:4 |
Conservation Information | |
---|---|
Conserved circRNAs | ath_circ_028385 |
PMCS | 0.535362926 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
52233920-52234354(-) |
Potential amino acid sequence |
MRPRARDKKLVEEWAVPLKSVEDIYERFRLYCLGKLRSNPWSELDGLQPETKIINEQLEKINTK GFLTINSQPAVNGEKSDSPTVEPWPN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017a |