Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0471350_circ_g.7 |
ID in PlantcircBase | osa_circ_007077 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 17482550-17482941 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os10g0471350 |
Parent gene annotation |
Similar to helicase domain-containing protein. (Os10t0471350-01) |
Parent gene strand | - |
Alternative splicing | Os10g0471350_circ_g.6 |
Support reads | 34 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0471350-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.118197279 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17482749-17482890(-) |
Potential amino acid sequence |
MSNETERRVESLLAKAKSNSNDSASTSTLTTRQSRPSTSSSVTESTKDIDKERLSSELRDIQNS RKQCVQQREDNCFQQSSTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |