Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0471350_circ_g.7 |
| ID in PlantcircBase | osa_circ_007077 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 17482550-17482941 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0471350 |
| Parent gene annotation |
Similar to helicase domain-containing protein. (Os10t0471350-01) |
| Parent gene strand | - |
| Alternative splicing | Os10g0471350_circ_g.6 |
| Support reads | 34 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0471350-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.118197279 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17482749-17482890(-) |
| Potential amino acid sequence |
MSNETERRVESLLAKAKSNSNDSASTSTLTTRQSRPSTSSSVTESTKDIDKERLSSELRDIQNS RKQCVQQREDNCFQQSSTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |