Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0801600_circ_g.1 |
| ID in PlantcircBase | osa_circ_022304 |
| Alias | Os_ciR8926 |
| Organism | Oryza sativa |
| Position | chr3: 33426367-33426552 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0801600 |
| Parent gene annotation |
Similar to vacuolar protein sorting 35. (Os03t0801600-01);Simila r to vacuolar protein sorting 35. (Os03t0801600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0801600-01:1 Os03t0801600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.716522133 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33426450-33426549(+) |
| Potential amino acid sequence |
MCRGIQHPLRGLFLRSYLSQISRDKLPDIGSEYEGYLLCTVGSVYIKSKEAPAKDVLKDLVEMC RGIQHPLRGLFLRSYLSQISRDKLPDIGSEYEGYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRG IQHPLRGLFLRSYLSQISRDKLPDIGSEYEGYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQ HPLRGLFLRSYLSQISRDKLPDIGSEYE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |