Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0283000_circ_g.1 |
ID in PlantcircBase | osa_circ_019200 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 9709358-9709644 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0283000 |
Parent gene annotation |
Similar to In2-1 protein. (Os03t0283000-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-GC |
Number of exons covered | Os03t0283000-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.179151945 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9709578-9709421(+) 9709375-9709549(-) |
Potential amino acid sequence |
MSMYLIKSKLSPMILLLCSRDGSSFCCHSILGDQSGTHSLIEDI*(+) MTAEAAAIPGAQQQNHWREFGFDQVHRHQLCRPQIDS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |