Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0255200_circ_g.1 |
ID in PlantcircBase | osa_circ_018930 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8210033-8211306 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0255200 |
Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os03t0255200-01);Heat shock protein DnaJ, N-terminal domain cont aining protein. (Os03t0255200-02) |
Parent gene strand | - |
Alternative splicing | Os03g0255200_circ_g.2 Os03g0255200_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0255200-01:3 Os03t0255200-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.281286054 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8210055-8211267(-) 8211265-8211287(-) 8210038-8211247(-) |
Potential amino acid sequence |
MANILLWEGKGLNLGCSTIP*(-) MLAHSLAINPSRAARCPVTSRASSAPLGLVSSLAFSRGRKESVKLFINVDRYTKYSTPFCYAPR NTRITPLATASFGDTADSSTPIFPRIHVKDPYQRLGISREASEEEIRAARNFLINKYAGHKPSV DAIESAHDRIIMQSFSDRKKPKVDLKKKYRELTQSRPVKAIQGRFQTPSSKVIWQTAITFVLLG VLTLVFPTEEGPTLQVAISCAANIYFIYQRLKSGWRTFFYGRGKASI*(-) MGGERPQFRLFNYSLRCWHIV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |