Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0255200_circ_g.1 |
| ID in PlantcircBase | osa_circ_018930 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8210033-8211306 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0255200 |
| Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os03t0255200-01);Heat shock protein DnaJ, N-terminal domain cont aining protein. (Os03t0255200-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0255200_circ_g.2 Os03g0255200_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0255200-01:3 Os03t0255200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.281286054 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8210055-8211267(-) 8211265-8211287(-) 8210038-8211247(-) |
| Potential amino acid sequence |
MANILLWEGKGLNLGCSTIP*(-) MLAHSLAINPSRAARCPVTSRASSAPLGLVSSLAFSRGRKESVKLFINVDRYTKYSTPFCYAPR NTRITPLATASFGDTADSSTPIFPRIHVKDPYQRLGISREASEEEIRAARNFLINKYAGHKPSV DAIESAHDRIIMQSFSDRKKPKVDLKKKYRELTQSRPVKAIQGRFQTPSSKVIWQTAITFVLLG VLTLVFPTEEGPTLQVAISCAANIYFIYQRLKSGWRTFFYGRGKASI*(-) MGGERPQFRLFNYSLRCWHIV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |