Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G46420_circ_g.4 |
ID in PlantcircBase | ath_circ_018715 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 19055559-19055744 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G46420 |
Parent gene annotation |
At2g46420/F11C10.11 |
Parent gene strand | + |
Alternative splicing | AT2G46420_circ_g.1 AT2G46420_circ_g.2 AT2G46420_circ_g.3 AT2G46420_circ_g.5 |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G46420.2:1 AT2G46420.3:1 AT2G46420.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.449951689 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19055714-19055741(+) |
Potential amino acid sequence |
MQNGIHPMASVWQKLEEENAEFFRAYYIRLKLKKQIVVFNHLLEHQYHLTKYNVHSKVPLVPMQ NGIHPMASVWQKLEEENAEFFRAYYIRLKLKKQIVVFNHLLEHQYHLTKYNVHSKVPLVPMQNG IHPMASVWQKLEEENAEFFRAYYIRLKLKKQIVVFNHLLEHQYHLTKYNVHSKVPLVPMQNGIH PMAS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |