Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0776000_circ_g.3 |
| ID in PlantcircBase | osa_circ_022095 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 32176503-32176833 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0776000 |
| Parent gene annotation |
Glucose-6-phosphate isomerase, cytosolic A (EC 5.3.1.9) (GPI-A) (Phosphoglucose isomerase A) (PGI-A) (Phosphohexose isomerase A) (PHI- A). (Os03t0776000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0776000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.225694789 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32176817-32176507(+) |
| Potential amino acid sequence |
MLPSRQINSTENRSVLHVALRAPRDEVINSNGVNVVPEVWGVKDKIKQFSETFRSGSWVGATGK ALTNVVSVGIGGSFLGPLFVHAALQTDK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |