Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0735025_circ_g.2 |
| ID in PlantcircBase | osa_circ_021679 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30101072-30101521 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0735000 |
| Parent gene annotation |
Similar to Glucose-1-phosphate adenylyltransferase large subunit 2 (EC 2.7.7.27) (ADP-glucose synthase) (ADP-glucose pyrophospho rylase) (AGPASE S) (Alpha-D-glucose-1-phosphate adenyl transfera se) (BLPL) (Fragment). (Os03t0735000-01);Similar to Glucose-1-ph osphate adenylyltransferase. (Os03t0735000-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0735025_circ_g.1 Os03g0735000_circ_g.1 Os03g0735025_circ_g.3 Os03g0735025_circ_g.4 Os03g0735025_circ_g.5 Os03g0735000_circ_g.6 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0735025-00:2 Os03t0735000-01:2 Os03t0735025-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.182409185 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30101124-30101074(-) |
| Potential amino acid sequence |
MYTSRRNLPPSMINNSKAYLFNDYWEDIGTIKSFFEANLSLAEQPPRFSFYDANKPMYTSRRNL PPSMINNSKAYLFNDYWEDIGTIKSFFEANLSLAEQPPRFSFYDANKPMYTSRRNLPPSMINNS KAYLFNDYWEDIGTIKSFFEANLSLAEQPPRFSFYDANKPMYTSRRNLPPSMINNSK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |