Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0558500_circ_g.5 |
ID in PlantcircBase | osa_circ_034256 |
Alias | Os_ciR11008 |
Organism | Oryza sativa |
Position | chr7: 22320981-22321911 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0558500 |
Parent gene annotation |
Inositol phosphatase-like protein. (Os07t0558500-01);Similar to Protein THYLAKOID FORMATION1, chloroplastic. (Os07t0558500-02) |
Parent gene strand | - |
Alternative splicing | Os07g0558500_circ_g.3 Os07g0558500_circ_g.4 |
Support reads | 2/2 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0558500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007261* osi_circ_017203 zma_circ_002593 |
PMCS | 0.29058848 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22321843-22321060(+) 22321884-22321881(-) |
Potential amino acid sequence |
MLRIGRLYDLRKFIFVSATVGGTSCLVWLALLHLQAQANGTSQLQRTGCS*(+) MNFLKSYKRPILSIYSTVLQELLVQQHLMRYKTTYQYDAVFALGFVTVYDQLMEGYPSNEDRDA IFKAYITALNEDPEQYRADAQKMEEWARSQNGNSLVEFSSKDGEIEAILKDISERAQGKGSFSY SRFFAVGLFRLLELANATEPTILDKMFHPLSQKQR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |