Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0558500_circ_g.5 |
| ID in PlantcircBase | osa_circ_034256 |
| Alias | Os_ciR11008 |
| Organism | Oryza sativa |
| Position | chr7: 22320981-22321911 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0558500 |
| Parent gene annotation |
Inositol phosphatase-like protein. (Os07t0558500-01);Similar to Protein THYLAKOID FORMATION1, chloroplastic. (Os07t0558500-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0558500_circ_g.3 Os07g0558500_circ_g.4 |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0558500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007261* osi_circ_017203 zma_circ_002593 |
| PMCS | 0.29058848 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22321843-22321060(+) 22321884-22321881(-) |
| Potential amino acid sequence |
MLRIGRLYDLRKFIFVSATVGGTSCLVWLALLHLQAQANGTSQLQRTGCS*(+) MNFLKSYKRPILSIYSTVLQELLVQQHLMRYKTTYQYDAVFALGFVTVYDQLMEGYPSNEDRDA IFKAYITALNEDPEQYRADAQKMEEWARSQNGNSLVEFSSKDGEIEAILKDISERAQGKGSFSY SRFFAVGLFRLLELANATEPTILDKMFHPLSQKQR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |