Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G77720_circ_g.1 |
ID in PlantcircBase | ath_circ_010669 |
Alias | At_ciR4727 |
Organism | Arabidpsis thaliana |
Position | chr1: 29212711-29212911 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G77720 |
Parent gene annotation |
At1g77720 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G77720.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.240091086 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29212753-29212908(+) |
Potential amino acid sequence |
MSNKDGRVKEDGFIYMVLEYGEIDLAHMLSQKWREIEGSDRTIDENWLRFYWQVTDKTLLQEVL NGTMSNKDGRVKEDGFIYMVLEYGEIDLAHMLSQKWREIEGSDRTIDENWLRFYWQVTDKTLLQ EVLNGTMSNKDGRVKEDGFIYMVLEYGEIDLAHMLSQKWREIEGSDRTIDENWLRFYWQVTDKT LLQEVLNGTMSNKDGRVKEDGFIYMVLEYGEIDLAHMLSQKWREIEGSDRTIDENWLRFYWQ(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |