Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0287800_circ_g.4 |
| ID in PlantcircBase | osa_circ_027245 |
| Alias | Os_ciR9765 |
| Organism | Oryza sativa |
| Position | chr5: 12457109-12457233 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os05g0287800 |
| Parent gene annotation |
Similar to Phosphatidic acid phosphatase-like protein. (Os05t028 7800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/shoot, root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0287800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.334 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12457199-12457150(+) 12457159-12457195(-) 12457140-12457146(-) |
| Potential amino acid sequence |
MLNGNSVDSADWNFLTDQLDQHLYYL*(+) MLTGSTDVDPADRSGSSNQQNQQSYHSTF*(-) MLIQLIGQEVPISRINRVTIQHSSLILFQLAVFLLYAHR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |