Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0018s11600_circ_g.2 |
| ID in PlantcircBase | pop_circ_004179 |
| Alias | Chr18:13323936|13325668 |
| Organism | Populus trichocarpa |
| Position | chr18: 12265840-12267572 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | POPTR_0018s11600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem cambium |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0018s11600.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.146091234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12267510-12265886(+) 12265867-12267442(-) 12267539-12267506(-) |
| Potential amino acid sequence |
MVAERTSLYMEAIFVASSASTAFLHPGYRHKLKHLQV*(+) MPVTRVQKSGTGRRSYKDCFHVQRCSFSYHLECRAVQRVENGILSGCCCSFC*(-) MYSDVLSATILNAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPTKAKLALVGKGLTFDS GGYNIKTGPGCFIELMKFDMGGSAAVLGAAKAIGQVKPPGVEVHFIVAACENMISGTGMRPGDI VTASNGKTIEVNNTDAEGRLTLADALVYACNQGAEKRYWQKKLQRLLPCTAMFFQLPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zheng et al., 2020 |