Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0976600_circ_g.1 |
ID in PlantcircBase | osa_circ_006063 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 43160198-43161727 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os01g0976600 |
Parent gene annotation |
Similar to Methlytransferase, UbiE/COQ5 family. (Os01t0976600-01 ) |
Parent gene strand | - |
Alternative splicing | Os01g0976600_circ_g.2 |
Support reads | 6 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0976600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147138611 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
43161676-43161688(-) |
Potential amino acid sequence |
MQGTLTDIEEETQIYVCDINPNMLNVGKKRASERGYKEGHCLSWIQGDAEALSFEDGSMDGYTI AFGIRNVTHIEKALSEAYRVLKRGGRFLCLELSHVDVPLFKEIYDVYSFSVIPAVGELVAGDRQ SYQYLVESIRRFPNQGMLPSVRSRESIA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |