Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g112020.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000553 |
| Alias | 1:89911439|89912002 |
| Organism | Solanum lycopersicum |
| Position | chr1: 98150639-98151202 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc01g112020.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc01g112020.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.185003901 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
98150947-98151175(-) |
| Potential amino acid sequence |
MLLDGIKPERDTFHSLLIGTMKGARLQDAFFFREEMKAMGFVPDVSLYNFLISTCGKCKNSEQA ISHPKIYSFEE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018 |