Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0502700_circ_g.2 |
ID in PlantcircBase | osa_circ_037607 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 24828655-24828865 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0502700 |
Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os08t0502700-01);Similar to ser ine--glyoxylate aminotransferase. (Os08t0502700-03) |
Parent gene strand | - |
Alternative splicing | Os08g0502700_circ_g.1 Os08g0502700_circ_g.3 Os08g0502700_circ_g.4 Os08g0502700_circ_g.5 Os08g0502700_circ_g.6 Os08g0502700_circ_g.7 Os08g0502700_circ_g.8 Os08g0502700_circ_g.9 Os08g0502700_circ_g.10 Os08g0502700_circ_g.11 Os08g0502700_circ_g.12 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0502700-03:1 Os08t0502700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.532449936 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24828774-24828659(+) |
Potential amino acid sequence |
MYGGTTTAVTVSLNHSSFCVQFLSPHASTASLVEVAEVADPEHLAGDLVEAEAEAEVVPLPGVL HDLGAVDVRRHDDGGDGVAEPLLLLRAVLEPPRLHGQPR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |