Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0502700_circ_g.2 |
| ID in PlantcircBase | osa_circ_037607 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 24828655-24828865 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0502700 |
| Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os08t0502700-01);Similar to ser ine--glyoxylate aminotransferase. (Os08t0502700-03) |
| Parent gene strand | - |
| Alternative splicing | Os08g0502700_circ_g.1 Os08g0502700_circ_g.3 Os08g0502700_circ_g.4 Os08g0502700_circ_g.5 Os08g0502700_circ_g.6 Os08g0502700_circ_g.7 Os08g0502700_circ_g.8 Os08g0502700_circ_g.9 Os08g0502700_circ_g.10 Os08g0502700_circ_g.11 Os08g0502700_circ_g.12 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0502700-03:1 Os08t0502700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.532449936 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24828774-24828659(+) |
| Potential amino acid sequence |
MYGGTTTAVTVSLNHSSFCVQFLSPHASTASLVEVAEVADPEHLAGDLVEAEAEAEVVPLPGVL HDLGAVDVRRHDDGGDGVAEPLLLLRAVLEPPRLHGQPR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |