Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0407200_circ_g.2 |
| ID in PlantcircBase | osa_circ_037027 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 19466992-19467135 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0407200 |
| Parent gene annotation |
Auxin polar transport and distribution, Plant architecture and g rain yield (Os08t0407200-01);Similar to predicted protein. (Os08 t0407200-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0407200-01:1 Os08t0407200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.269097454 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19467015-19467132(+) 19467117-19467118(-) |
| Potential amino acid sequence |
MSMLLNSLTMGHQHQLQRNNCMTSLLMVCVVVIHLSALVHRDRGECGVMSMLLNSLTMGHQHQL QRNNCMTSLLMVCVVVIHLSALVHRDRGECGVMSMLLNSLTMGHQHQLQRNNCMTSLLMVCVVV IHLSALVHRDRGECGVMSMLLNSLTMGHQHQLQRNNCMTSLLMVCVVVIHLSALVH(+) MDHYHADHQQARHTIVPLELVLVPHSKRIQQHRHHTTLPPVPVNQSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |