Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0190000_circ_g.1 |
| ID in PlantcircBase | osa_circ_006376 |
| Alias | Os_ciR6972 |
| Organism | Oryza sativa |
| Position | chr10: 6247639-6248546 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0190000 |
| Parent gene annotation |
Similar to Ubiquitin-conjugating enzyme E2 M (EC 6.3.2.19) (Ubiq uitin-protein ligase M) (Ubiquitin carrier protein M) (Nedd8-con jugating enzyme Ubc12). (Os10t0190000-01);Similar to Ubiquitin c arrier protein. (Os10t0190000-02) |
| Parent gene strand | + |
| Alternative splicing | Os10g0190000_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0190000-02:3 Os10t0190000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.245848431 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6247705-6247650(+) 6247722-6248544(-) |
| Potential amino acid sequence |
MNFEIIVRPDEGYYLGGTFVFTFQVSPSYPHEPPKVKCKTKVYHPNIDLEGNVCLNILREDWKP VLNINTVIYGLNLLFTILVS*(+) MISKFIRSSLPLGKEIDVLLGRFSSLIS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |