Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0497100_circ_g.7 |
ID in PlantcircBase | osa_circ_033926 |
Alias | Os_ciR10952 |
Organism | Oryza sativa |
Position | chr7: 18636137-18637903 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os07g0497100 |
Parent gene annotation |
Chromodomain, helicase/ATPase, and DNA-binding domain (CHD) prot ein, Chromatin-remodeling factor, Mi-2-like protein, Crown root development, Chloroplast development in adaxial mesophyll, Maint enance of H3K4me3 (Os07t0497100-01) |
Parent gene strand | - |
Alternative splicing | Os07g0497100_circ_g.6 Os07g0497100_circ_g.8 Os07g0497100_circ_g.9 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0497100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007194* osi_circ_007195* |
PMCS | 0.36246022 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18637885-18637885(-) |
Potential amino acid sequence |
MMKERSSLCESAADGSWVLKYKRKRSKLTVSPSSEHDASSPILDSQMNNGSIKKKIKHDTNISP STKKIRGHDGYFYECVECDLGGNLLCCDSCPRTYHLECLNPPLKRAPPGNWQCPRCRTKKVSLK LLDNADADTSKRERTRRMRTSTTSDSPSPSPQNKASFNTSRGAAFRDDEPGAKDNEVEKRKPLI LHLKKRSTKELSTDTTSSKSGLLGKSSEEKQEKHGSALKVKKHLHPMELSPKKYKNKKQHNHRD SKRSEAKKVQYLASDVDSDSSMEPSTSLEHSESPPPKRKSLDGRTPASSTKKGKKKVKFVDKKH PEHVTLIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |