Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0497100_circ_g.7 |
| ID in PlantcircBase | osa_circ_033926 |
| Alias | Os_ciR10952 |
| Organism | Oryza sativa |
| Position | chr7: 18636137-18637903 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0497100 |
| Parent gene annotation |
Chromodomain, helicase/ATPase, and DNA-binding domain (CHD) prot ein, Chromatin-remodeling factor, Mi-2-like protein, Crown root development, Chloroplast development in adaxial mesophyll, Maint enance of H3K4me3 (Os07t0497100-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0497100_circ_g.6 Os07g0497100_circ_g.8 Os07g0497100_circ_g.9 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0497100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007194* osi_circ_007195* |
| PMCS | 0.36246022 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18637885-18637885(-) |
| Potential amino acid sequence |
MMKERSSLCESAADGSWVLKYKRKRSKLTVSPSSEHDASSPILDSQMNNGSIKKKIKHDTNISP STKKIRGHDGYFYECVECDLGGNLLCCDSCPRTYHLECLNPPLKRAPPGNWQCPRCRTKKVSLK LLDNADADTSKRERTRRMRTSTTSDSPSPSPQNKASFNTSRGAAFRDDEPGAKDNEVEKRKPLI LHLKKRSTKELSTDTTSSKSGLLGKSSEEKQEKHGSALKVKKHLHPMELSPKKYKNKKQHNHRD SKRSEAKKVQYLASDVDSDSSMEPSTSLEHSESPPPKRKSLDGRTPASSTKKGKKKVKFVDKKH PEHVTLIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |