Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0723400_circ_g.3 |
| ID in PlantcircBase | osa_circ_003724 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 30167457-30167531 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRI, PcircRNA_finder |
| Parent gene | Os01g0723400 |
| Parent gene annotation |
NADP-malic enzyme, Splicing variant (Os01t0723400-01);Similar to Malic enzyme. (Os01t0723400-02);NADP-malic enzyme, Salt and osm otic stress tolerance, Disease resistance (Os01t0723400-03);NADP -malic enzyme, Splicing variant (Os01t0723400-04);NADP-malic enz yme, Splicing variant (Os01t0723400-05) |
| Parent gene strand | + |
| Alternative splicing | Os01g0723400_circ_g.4 Os01g0723400_circ_g.5 Os01g0723400_circ_g.6 |
| Support reads | 5 |
| Tissues | anther, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0723400-02:1 Os01t0723400-05:1 Os01t0723400-04:1 Os01t0723400-03:1 Os01t0723400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.376670222 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30167470-30167528(+) 30167476-30167459(-) 30167514-30167459(-) |
| Potential amino acid sequence |
MHNIRQYQLPLQKYMAMMDLQERKIMHNIRQYQLPLQKYMAMMDLQERKIMHNIRQYQLPLQKY MAMMDLQERKIMHNIRQYQLPLQKYMAMMDLQ(+) MHDFPFLEVHHSHVFLQRQLVLSDVMHDFPFLEVHHSHVFLQRQLVLSDVMHDFPFLEVHHSHV FLQRQLVLSDVMHDFPF(-) MYFCRGSWYCRMLCMIFLSWRSIIAMYFCRGSWYCRMLCMIFLSWRSIIAMYFCRGSWYCRMLC MIFLSWRSIIAMYFCRGSWYCRMLCMIFL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |