Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0398700_circ_g.3 |
ID in PlantcircBase | osa_circ_037003 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 19029116-19029485 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0398700 |
Parent gene annotation |
Peptidase M1, membrane alanine aminopeptidase family protein. (O s08t0398700-01);Similar to APM1 (AMINOPEPTIDASE M1). (Os08t03987 00-02) |
Parent gene strand | + |
Alternative splicing | Os08g0398700_circ_ag.1 Os08g0398700_circ_igg.1 Os08g0398800_circ_g.1 Os08g0399050_circ_ig.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0398700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017888 |
PMCS | 0.196398243 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19029163-19029120(+) 19029273-19029404(-) |
Potential amino acid sequence |
MLRSLLLIALVKLGHDETINEGVRRFHIFIKDRKTNILPPDTRKASYLAVMRTVTTSSRAGYDA LLKIYRETAEAQEKSRILEH*(+) MLVLRSFMKIWNRLTPSFIVSSCPSLTRAIKSNDLSITSRWLSPSLGSQPSVLRCVTSPELQLF LCRFSGGHHNQLCWR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |