Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0398700_circ_g.3 |
| ID in PlantcircBase | osa_circ_037003 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 19029116-19029485 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0398700 |
| Parent gene annotation |
Peptidase M1, membrane alanine aminopeptidase family protein. (O s08t0398700-01);Similar to APM1 (AMINOPEPTIDASE M1). (Os08t03987 00-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0398700_circ_ag.1 Os08g0398700_circ_igg.1 Os08g0398800_circ_g.1 Os08g0399050_circ_ig.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0398700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017888 |
| PMCS | 0.196398243 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19029163-19029120(+) 19029273-19029404(-) |
| Potential amino acid sequence |
MLRSLLLIALVKLGHDETINEGVRRFHIFIKDRKTNILPPDTRKASYLAVMRTVTTSSRAGYDA LLKIYRETAEAQEKSRILEH*(+) MLVLRSFMKIWNRLTPSFIVSSCPSLTRAIKSNDLSITSRWLSPSLGSQPSVLRCVTSPELQLF LCRFSGGHHNQLCWR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |