Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0171900_circ_g.1 |
ID in PlantcircBase | osa_circ_029842 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 3634540-3634891 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0171900 |
Parent gene annotation |
WD40 subfamily protein, Salt stress (Os06t0171900-01);Similar to GAMYB-binding protein (Fragment). (Os06t0171900-02) |
Parent gene strand | + |
Alternative splicing | Os06g0171900_circ_g.2 Os06g0171900_circ_g.3 Os06g0171900_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0171900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_009038* zma_circ_002300 |
PMCS | 0.368302888 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3634700-3634888(+) |
Potential amino acid sequence |
MDKICKQVDKISKYYEFHYNTRLVKPSILHFQLTRITDTSAAEARAGKDIQGIPWERLQITRSD YRKARLVQYKNYENFPQSGELMDKICKQVDKISKYYEFHYNTRLVKPSILHFQLTRITDTSAAE ARAGKDIQGIPWERLQITRSDYRKARLVQYKNYENFPQSGELMDKICKQVDKISKYYEFHYNTR LVKPSILHFQLTRITDTSAAEARAGKDIQGIPWERLQITRSDYRKARLVQYKNYENFPQSGELM DKICKQVDKISKYYEFHYNTRLVKPSILHFQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |