Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0171900_circ_g.1 |
| ID in PlantcircBase | osa_circ_029842 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 3634540-3634891 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0171900 |
| Parent gene annotation |
WD40 subfamily protein, Salt stress (Os06t0171900-01);Similar to GAMYB-binding protein (Fragment). (Os06t0171900-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0171900_circ_g.2 Os06g0171900_circ_g.3 Os06g0171900_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0171900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_009038* zma_circ_002300 |
| PMCS | 0.368302888 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3634700-3634888(+) |
| Potential amino acid sequence |
MDKICKQVDKISKYYEFHYNTRLVKPSILHFQLTRITDTSAAEARAGKDIQGIPWERLQITRSD YRKARLVQYKNYENFPQSGELMDKICKQVDKISKYYEFHYNTRLVKPSILHFQLTRITDTSAAE ARAGKDIQGIPWERLQITRSDYRKARLVQYKNYENFPQSGELMDKICKQVDKISKYYEFHYNTR LVKPSILHFQLTRITDTSAAEARAGKDIQGIPWERLQITRSDYRKARLVQYKNYENFPQSGELM DKICKQVDKISKYYEFHYNTRLVKPSILHFQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |