Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0209200_circ_g.2 |
ID in PlantcircBase | osa_circ_000796 |
Alias | Os_ciR2489 |
Organism | Oryza sativa |
Position | chr1: 5933212-5933360 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0209200 |
Parent gene annotation |
Similar to 14-3-3 protein 7. (Os01t0209200-01) |
Parent gene strand | + |
Alternative splicing | Os01g0209200_circ_g.1 |
Support reads | 14 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0209200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.348142338 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5933304-5933297(+) |
Potential amino acid sequence |
MQLLRDNLALWNSDMADDAELANLLRTPLMKLLRSFPPSVRRITKIVH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |