Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0178300_circ_g.4 |
| ID in PlantcircBase | osa_circ_023027 |
| Alias | Os04circ01094/Os_ciR2193 |
| Organism | Oryza sativa |
| Position | chr4: 5321840-5322198 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os04g0178300 |
| Parent gene annotation |
Similar to Isoform 3 of Syn-copalyl diphosphate synthase. (Os04t 0178300-01);Similar to Syn-copalyl diphosphate synthase. (Os04t0 178300-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0178300_circ_g.1 Os04g0178300_circ_g.2 Os04g0178300_circ_g.3 |
| Support reads | 3/6/2/2 |
| Tissues | leaf and panicle/root/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0178300-02:2 Os04t0178300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.395991713 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5322143-5321893(+) 5322154-5322195(+) |
| Potential amino acid sequence |
MTRPWVSVSSDFTDTKSTHFPVSTLWMCTNAYGPSIG*(+) MGFRLLRLYGYQVDPFPCIYPLDVYERLWAVDRLTRLGISRHFTSEIEDCLDYIFRNWTPDGLA HTKNCPVKDIDDTAMGFRLLRLYGYQVDPFPCIYPLDVYERLWAVDRLTRLGISRHFTSEIEDC LDYIFRNWTPDGLAHTKNCPVKDIDDTAMGFRLLRLYGYQVDPFPCIYPLDVYERLWAVDRLTR LGISRHFTSEIEDCLDYIFRNWTPDGLAHTKNCPVKDIDDTAMGFRLLRLYGYQVDP(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |