Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0616500_circ_g.2 |
ID in PlantcircBase | osa_circ_042647 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 25410892-25411365 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os07g0616500 |
Parent gene annotation |
Similar to (S)-2-hydroxy-acid oxidase, peroxisomal (EC 1.1.3.15) (Glycolate oxidase) (GOX) (Short chain alpha-hydroxy acid oxida se). (Os07t0616500-01) |
Parent gene strand | + |
Alternative splicing | Os07g0616500_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0616500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152585425 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25410894-25410912(+) 25410940-25410912(+) 25411362-25411316(-) |
Potential amino acid sequence |
MVFPRSGNLEGLMTTDDHDTTNGSQLERFARATLDPSLSWKNGFPTEW*(+) MTMIPQTVLSSNDSHERRWIHHYHGRMVFPRSGNLEGLMTTDDHDTTNGSQLERFARATLDPSL SWKNGFPTEW*(+) MIMMDPASLVRIVRAENRLWYHGHLLSLNLRDYHSVGKPFFHDNDGSSVARANRSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |