Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0616500_circ_g.2 |
| ID in PlantcircBase | osa_circ_042647 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25410892-25411365 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os07g0616500 |
| Parent gene annotation |
Similar to (S)-2-hydroxy-acid oxidase, peroxisomal (EC 1.1.3.15) (Glycolate oxidase) (GOX) (Short chain alpha-hydroxy acid oxida se). (Os07t0616500-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0616500_circ_g.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0616500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152585425 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25410894-25410912(+) 25410940-25410912(+) 25411362-25411316(-) |
| Potential amino acid sequence |
MVFPRSGNLEGLMTTDDHDTTNGSQLERFARATLDPSLSWKNGFPTEW*(+) MTMIPQTVLSSNDSHERRWIHHYHGRMVFPRSGNLEGLMTTDDHDTTNGSQLERFARATLDPSL SWKNGFPTEW*(+) MIMMDPASLVRIVRAENRLWYHGHLLSLNLRDYHSVGKPFFHDNDGSSVARANRSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |