Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0525600_circ_g.11 |
| ID in PlantcircBase | osa_circ_037766 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 26141807-26141929 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0525600 |
| Parent gene annotation |
Similar to Peptidylprolyl isomerase; FK506-binding protein. (Os0 8t0525600-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0525600_circ_g.3 Os08g0525600_circ_g.4 Os08g0525600_circ_g.5 Os08g0525600_circ_g.6 Os08g0525600_circ_g.7 Os08g0525600_circ_g.8 Os08g0525600_circ_g.9 Os08g0525600_circ_g.10 Os08g0525600_circ_g.12 |
| Support reads | 19 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0525600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.317083604 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26141878-26141825(+) 26141884-26141906(-) |
| Potential amino acid sequence |
MHCSSWANMSGLQSVMRRIKNLGT*(+) MHSPLLSLPQQSQSSRYCSSPKILYPSHNALKP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |