Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_07G245700_circ_g.1 |
| ID in PlantcircBase | gma_circ_001841 |
| Alias | Gm07circRNA562, gma-circRNA0970 |
| Organism | Glycine max |
| Position | chr7: 42473036-42473578 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | Tophat, CIRI, find_circ |
| Parent gene | GLYMA_07G245700 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_07G245700_circ_g.2 GLYMA_07G245700_circ_g.3 GLYMA_07G245700_circ_g.4 |
| Support reads | NA |
| Tissues | leaf, root, stem, flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH50812:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.254692388 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42473102-42473101(+) |
| Potential amino acid sequence |
MSPLAKWHRSKPGLTERFQLFVNKRELCYAYTELNDPVVQRQRFAEQLKDRQSGDDEAMALDET FCTALEYGLPPTGGWGLGIDRFTMLLTDSQNIKLVGHFLEETCVNPTFIINHLRS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018 |