Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA004467_circ_g.4 |
| ID in PlantcircBase | osi_circ_002389 |
| Alias | 1:34692751|34694252 |
| Organism | Oryza sativa ssp. indica |
| Position | chr1: 34692751-34694252 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA004467 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA004467_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA004467-TA:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_003909* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34692810-34693184(-) 34693129-34693896(-) |
| Potential amino acid sequence |
MVTPRILFIFIVCLVTQVNPSASQMIQFQNALCSSLKIVLHHNMPARHQVQEQLLRIHPSKPFS IEMNQ*(-) MTVEAPKSQIFAGFQAVLLGNTSGEHQQHGCQVYFLFYPVKPHGDSSYPLHLHRLSGDTGQPFR FSDDPVSERTLLIFENSIAP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |