Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d020297_circ_g.1 |
| ID in PlantcircBase | zma_circ_009331 |
| Alias | zma_circ_0002532 |
| Organism | Zea mays |
| Position | chr7: 104761642-104769488 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d020297 |
| Parent gene annotation |
serine/threonine protein kinase 3 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d020297_T004:4 Zm00001d020297_T003:2 Zm00001d020297_T005:2 Zm00001d020297_T002:4 Zm00001d020297_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12640495 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
104762843-104769370(-) |
| Potential amino acid sequence |
MLSRREFYSTADVLQIFQQMCEGLKHMHSFDPPYAHNDVKPGNVLITWRKGQAPVATLMDFGSA RPARKEIRSRSEALQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLFAIIGWNVC HEEGADTEQGAVGSGEGGDPCVVLIQSPQPSAAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |