Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d020297_circ_g.1 |
ID in PlantcircBase | zma_circ_009331 |
Alias | zma_circ_0002532 |
Organism | Zea mays |
Position | chr7: 104761642-104769488 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d020297 |
Parent gene annotation |
serine/threonine protein kinase 3 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d020297_T004:4 Zm00001d020297_T003:2 Zm00001d020297_T005:2 Zm00001d020297_T002:4 Zm00001d020297_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.12640495 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
104762843-104769370(-) |
Potential amino acid sequence |
MLSRREFYSTADVLQIFQQMCEGLKHMHSFDPPYAHNDVKPGNVLITWRKGQAPVATLMDFGSA RPARKEIRSRSEALQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLFAIIGWNVC HEEGADTEQGAVGSGEGGDPCVVLIQSPQPSAAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |