Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039758_circ_g.1 |
ID in PlantcircBase | zma_circ_007508 |
Alias | zma_circ_0001173 |
Organism | Zea mays |
Position | chr3: 14129822-14131850 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d039758 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d039758_T003:3 Zm00001d039758_T006:4 Zm00001d039758_T002:3 Zm00001d039758_T004:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.093852834 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14131773-14129844(+) 14129862-14131817(-) 14129866-14131785(-) |
Potential amino acid sequence |
MNPHQRKVWTVQLFSTNWLTNLLKNTGPWEKKII*(+) MITVLKLFSFPMVLCFSASLLTNL*(-) MHDHSTQIIFFSHGPVFFSKFVNQFVENNCTVQTFL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |