Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d039758_circ_g.1 |
| ID in PlantcircBase | zma_circ_007508 |
| Alias | zma_circ_0001173 |
| Organism | Zea mays |
| Position | chr3: 14129822-14131850 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d039758 |
| Parent gene annotation |
ARM repeat superfamily protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d039758_T003:3 Zm00001d039758_T006:4 Zm00001d039758_T002:3 Zm00001d039758_T004:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.093852834 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14131773-14129844(+) 14129862-14131817(-) 14129866-14131785(-) |
| Potential amino acid sequence |
MNPHQRKVWTVQLFSTNWLTNLLKNTGPWEKKII*(+) MITVLKLFSFPMVLCFSASLLTNL*(-) MHDHSTQIIFFSHGPVFFSKFVNQFVENNCTVQTFL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |