Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0524100_circ_g.2 |
ID in PlantcircBase | osa_circ_042601 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 20343045-20343829 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os07g0524100 |
Parent gene annotation |
Thioredoxin domain 2 containing protein. (Os07t0524100-01) |
Parent gene strand | + |
Alternative splicing | Os07g0524100_circ_g.3 Os07g0524100_circ_g.4 Os07g0524100_circ_g.5 Os07g0524100_circ_g.6 Os07g0524100_circ_g.7 |
Support reads | NA |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0524100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.167178705 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20343752-20343651(+) 20343660-20343820(-) 20343075-20343744(-) |
Potential amino acid sequence |
MEMMLKKTMMMVQFPCPLAILIAIHTTFLHFHANLHQLMSVMFWEQTD*(+) MFNLFVPRTSLTSTDANSHESAGKWCE*(-) MQIRMKVQESGVNSYQNCERTRELNHHHGFLQHHLHVC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |