Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0465400_circ_g.3 |
ID in PlantcircBase | osa_circ_014605 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 15645167-15646536 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0465400 |
Parent gene annotation |
Similar to 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC r eductase) (Sterol delta-7-reductase) (Dwarf5 protein). (Os02t046 5400-01) |
Parent gene strand | - |
Alternative splicing | Os02g0465400_circ_g.2 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0465400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.129308777 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15646498-15645412(+) |
Potential amino acid sequence |
MLSRSLHMLVSHLPSRNQLSHSLRIQNQMKMEQDDPLCTEKYRTQSFQIQEQSIFPPSDRILLQ G*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |