Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0613300_circ_g.2 |
| ID in PlantcircBase | osa_circ_015491 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 24169376-24170483 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0613200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os02t0613200-01);Similar to regula tory subunit. (Os02t0613200-02);Similar to regulatory subunit. ( Os02t0613200-03);Similar to regulatory subunit. (Os02t0613200-04 ) |
| Parent gene strand | - |
| Alternative splicing | Os02g0613200_circ_g.1 Os02g0613300_circ_g.1 Os02g0613300_circ_g.3 Os02g0613200_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0613300-00:2 Os02t0613200-04:3 Os02t0613300-00:2 Os02t0613200-01:3 Os02t0613200-03:3 Os02t0613200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109470051 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24169444-24169378(-) |
| Potential amino acid sequence |
MLLKSLELSDTEVGSSGLQHLSGLKKLKVLNLGFNNITDDCLAHLKELINLESLNLDSCKVGDE GLLHLRGLMLLKSLELSDTEVGSSGLQHLSGLKKLKVLNLGFNNITDDCLAHLKELINLESLNL DSCKVGDEGLLHLRGLMLLKSLELSDTEVGSSGLQHLSGLKKLKVLNLGFNNITDDCLAHLKEL INLESLNLDSCKVGDEGLLHLRGLMLLKSLELSDTEVGSSGLQHLS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |