Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0128600_circ_g.3 |
| ID in PlantcircBase | osa_circ_038483 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 2218223-2219159 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0128600 |
| Parent gene annotation |
CMP/dCMP deaminase, zinc-binding domain containing protein. (Os0 9t0128600-01);Similar to hydrolase/ zinc ion binding protein. (O s09t0128600-02);Non-protein coding transcript. (Os09t0128600-03) ;Similar to hydrolase/ zinc ion binding protein. (Os09t0128600-0 4);Similar to hydrolase/ zinc ion binding protein. (Os09t0128600 -05) |
| Parent gene strand | - |
| Alternative splicing | Os09g0128600_circ_g.1 Os09g0128600_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0128600-02:2 Os09t0128600-01:2 Os09t0128600-04:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119530799 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2218287-2219096(-) |
| Potential amino acid sequence |
MFPQDVKKIVGTYELNTFIAKAIESSMPIGESSACKTGASVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |