Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0678500_circ_g.2 |
ID in PlantcircBase | osa_circ_003219 |
Alias | Os_ciR6002 |
Organism | Oryza sativa |
Position | chr1: 27909226-27909521 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0678500 |
Parent gene annotation |
Voltage-gated Ca2+ channel protein, Elicitor-induced defense re ponses, Hypersensitive cell death, Activation of MAPK cascade (O s01t0678500-01);Voltage-gated Ca2+ channel protein, Elicitor-in duced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-02) |
Parent gene strand | - |
Alternative splicing | Os01g0678500_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0678500-02:2 Os01t0678500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.256472297 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27909509-27909289(+) 27909281-27909228(-) |
Potential amino acid sequence |
MPPNISIQACQLPITNKLNRVTIPLG*(+) MVTLFNLLVMGNWQAWMEIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGN WQAWMEIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQAWMEIFGGIV YAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQAWME(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |