Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G056900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000243 |
| Alias | Chr03:9315736|9316469 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 9315736-9316469 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G056900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G056900.1:4 Gorai.003G056900.2:4 Gorai.003G056900.3:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138444902 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9315783-9316447(-) 9315767-9316440(-) 9315739-9316447(-) |
| Potential amino acid sequence |
MILTCNGLGISHTSTWITTKFWK*(-) MGLVLVIHQHGLLQNFGSRL*(-) MDYYKILEVDYDATDENIRLSYRKLALKWHPDKHKGDSAVTAKFQEINEAYNVLIDPDKRFEYD LTGIYEIDKYTLREYLARFKGMILTCNGLGISHTSTWITTKFWK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |