Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa2G381720_circ_g.1 |
| ID in PlantcircBase | csa_circ_001218 |
| Alias | Chr2:19580504_19580960 |
| Organism | Cucumis sativus |
| Position | chrChr2: 19580504-19580960 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa2G381720 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Csa3G642670_circ_g.2 Csa3G642670_circ_g.3 Csa3G642670_circ_g.4 Csa3G642670_circ_g.5 Csa3G642670_circ_g.6 Chr3_circ_ig.91 Chr3_circ_ig.92 Chr3_circ_ig.93 Chr3_circ_ig.94 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa2G381720.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297927006 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19580850-19580958(-) 19580855-19580939(-) |
| Potential amino acid sequence |
MPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNNVQERFEVDIKELPEQIDTSTYS* MTCQILLIHICTGLAELVDLAPKGLQLLLYHLQLILMFSIMFKKGLKSILRSFQSRSTPPLTVD SIQRF* |
| Sponge-miRNAs | PC-5p-66456 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |