Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d007185_circ_g.1 |
ID in PlantcircBase | zma_circ_007407 |
Alias | zma_circ_0000946 |
Organism | Zea mays |
Position | chr2: 224108014-224108985 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d007185 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d007185_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.025393673 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
224108921-224108070(+) 224108051-224108072(-) |
Potential amino acid sequence |
MLIVAKNRLRRNFIVFIIREEFQFSYLMIIFRKHVPVALPI*(+) MLSEDNHQIAKLEFFSYDEDNKISSQPIFSYNQHFGEQSLHIHVEPPETVSSHKLEYYENFSMY NNQNDGDNLESSRQSYETQSYVHMPYDQLEPYRPSWSLNSGYYQACTEGITPEYDNHTLASDEN WDMSSLFMSPFYPQETRSYEQSHGDENV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |