Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0171000_circ_g.5 |
| ID in PlantcircBase | osa_circ_000470 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 3671211-3671909 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0171000 |
| Parent gene annotation |
BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precu rsor (EC 2.7.1.37) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3). (Os01t0171000-01);Similar to Leucine-rich repeat receptor-like kinase. (Os01t0171000-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0171000_circ_g.6 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0171000-01:4 Os01t0171000-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.150089986 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3671833-3671213(+) 3671853-3671865(-) 3671224-3671837(-) |
| Potential amino acid sequence |
MSSVCSIPNLPMLAGIVPDIALFCNSS*(+) MLQTLDMSDNQITGSIPSSIGDLKNLNYLKLNNNSLSGVLPDSLAAINGLALVDLSFNNLSGPL PKISSRTFNIVGNPMICGVKSGDNCSSVSMDPLSYPPDDLKSYYRTMQYLALFLPA*(-) MILRAITEQCNIWHYSCQHRQVGDAADA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |