Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0152950_circ_g.1 |
| ID in PlantcircBase | osa_circ_032797 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 2799358-2800176 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0152900 |
| Parent gene annotation |
Similar to Glycolate oxidase (EC 1.1.3.15) (Fragment). (Os07t015 2900-01);Similar to Glycolate oxidase. (Os07t0152900-02);Similar to Glycolate oxidase (EC 1.1.3.15) (Fragment). (Os07t0152900-03 );Similar to Glycolate oxidase (EC 1.1.3.15) (Fragment). (Os07t0 152900-04) |
| Parent gene strand | + |
| Alternative splicing | Os07g0152900_circ_g.1 Os07g0152900_circ_g.2 Os07g0152900_circ_g.3 Os07g0152900_circ_g.4 Os07g0152900_circ_g.5 Os07g0152900_circ_g.6 Os07g0152900_circ_g.7 Os07g0152950_circ_g.2 Os07g0152950_circ_g.3 Os07g0152950_circ_g.4 Os07g0152950_circ_g.5 Os07g0152950_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0152950-00:1 Os07t0152900-03:5 Os07t0152900-04:5 Os07t0152950-00:1 Os07t0152900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.181625438 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2799403-2799399(+) 2799386-2800125(-) |
| Potential amino acid sequence |
MTLSSWATSSVEEVASTGPGIRFFQLYVYKDRRVVEQLVRRAERAGFKAIALTVDTPRLGRREA DIKNRFVLPPFLTLKNFEGLELGKMDQASDSGLASYVAGQIDRTLSWKESMQLRVLHQQRAL*( +) MQHAQLHTLLPAQGAIDLPGDVRSQS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |