Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0785401_circ_g.1 |
ID in PlantcircBase | osa_circ_022154 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 32597166-32598143 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0785300 |
Parent gene annotation |
Zinc finger, C3HC-like domain containing protein. (Os03t0785300- 01);Nuclear-interacting partner of ALK/Rsm1-like domain containi ng protein. (Os03t0785300-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0785401-00:2 Os03t0785300-01:2 Os03t0785401-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005162* osi_circ_013731 |
PMCS | 0.266745706 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32598097-32597195(+) 32598120-32598096(-) |
Potential amino acid sequence |
MLATLACIAGDEGPAELQLETRMSMY*(+) MQANVASIDWSGSRQASRVDSSSHVAPHAHQPSHSFDATGTALDSAPSCRPWERGDLLRRLATY KPTTWASRPKAASSLACARRGWVNVDMDKIECESCGAHLIFSTLTSWSPAEVLQDPRHLLCKLM LPA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |