Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0785401_circ_g.1 |
| ID in PlantcircBase | osa_circ_022154 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 32597166-32598143 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0785300 |
| Parent gene annotation |
Zinc finger, C3HC-like domain containing protein. (Os03t0785300- 01);Nuclear-interacting partner of ALK/Rsm1-like domain containi ng protein. (Os03t0785300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0785401-00:2 Os03t0785300-01:2 Os03t0785401-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005162* osi_circ_013731 |
| PMCS | 0.266745706 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32598097-32597195(+) 32598120-32598096(-) |
| Potential amino acid sequence |
MLATLACIAGDEGPAELQLETRMSMY*(+) MQANVASIDWSGSRQASRVDSSSHVAPHAHQPSHSFDATGTALDSAPSCRPWERGDLLRRLATY KPTTWASRPKAASSLACARRGWVNVDMDKIECESCGAHLIFSTLTSWSPAEVLQDPRHLLCKLM LPA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |