Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G10160_circ_g.4 |
| ID in PlantcircBase | ath_circ_020771 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3140070-3140225 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
| Parent gene | AT3G10160 |
| Parent gene annotation |
Folylpolyglutamate synthase |
| Parent gene strand | - |
| Alternative splicing | AT3G10160_circ_g.1 AT3G10160_circ_g.2 AT3G10160_circ_g.3 |
| Support reads | 4 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G10160.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.302151345 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3140191-3140072(-) |
| Potential amino acid sequence |
MSTYNKVISGASAIPSDTRRKDLTWQFRLQRLWEKSIQGTGTHFSRALFVPSMSTYNKVISGAS AIPSDTRRKDLTWQFRLQRLWEKSIQGTGTHFSRALFVPSMSTYNKVISGASAIPSDTRRKDLT WQFRLQRLWEKSIQGTGTHFSRALFVPSMSTYNKVISGASAIPSDTRRKDLTWQFRLQRLWEKS IQGT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |