Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0467400_circ_g.1 |
| ID in PlantcircBase | osa_circ_037312 |
| Alias | Os_ciR11483 |
| Organism | Oryza sativa |
| Position | chr8: 22992024-22992683 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0467400 |
| Parent gene annotation |
Zinc/iron permease family protein. (Os08t0467400-01);Zinc/iron p ermease family protein. (Os08t0467400-02);Zinc/iron permease fam ily protein. (Os08t0467400-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0467400-01:2 Os08t0467400-02:2 Os08t0467400-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.270398497 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22992629-22992108(+) 22992208-22992247(-) |
| Potential amino acid sequence |
MLMRMIMILMIMCMRMPSTLRIADFESARVTPSVFSIAPSCEGSFSA*(+) MGHHHHHHKRHDRSDKAKLNHAEKDHEDKGVNQAEKEPSHDGAIEKTDGVTRADSKSAIRKVEG ILIHMIIRIIIILMSIHMHTLWKIFLLVCLFYLALCFSLLLRRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |