Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0242100_circ_g.1 |
| ID in PlantcircBase | osa_circ_008925 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 7597170-7598866 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0242100 |
| Parent gene annotation |
Beta-glucosidase, GBA2 type domain containing protein. (Os11t024 2100-01);Beta-glucosidase, GBA2 type domain containing protein. (Os11t0242100-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0242100_circ_g.2 Os11g0242100_circ_g.3 Os11g0242100_circ_g.4 Os11g0242100_circ_g.5 Os11g0242100_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0242100-01:5 Os11t0242100-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112960401 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7597192-7597172(+) 7597267-7598770(-) |
| Potential amino acid sequence |
MVENGVLEQPKGVSRNRPRAQSNDHPVDPGYLPELTWEHKLSNIGYDLPSFRLTWRETFQLAGL GLRLGRHILEETSKGRAAVIDPMKKRIAKSGQGVPLGGIGSGSIGRSYKGEFQRWQLFPGTCEE RPVLANQFSG*(+) MIIRLSTWPISRHPLWLLQNTILYHFKSFGLARKLICQYRSLFTSSREQLPALKLAFVAPSNTS *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |