Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0184900_circ_g.1 |
| ID in PlantcircBase | osa_circ_033023 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 4485475-4485549 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0184900 |
| Parent gene annotation |
ATP-dependent DNA helicase 2 subunit KU70, Maintenance of chromo somal stability, Developmental growth, Telomere length regulatio n (Os07t0184900-01);Hypothetical conserved gene. (Os07t0184900-0 2);Similar to Ku70 homolog. (Os07t0184900-03);Hypothetical conse rved gene. (Os07t0184900-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0184900-01:1 Os07t0184900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.248889778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4485497-4485546(+) |
| Potential amino acid sequence |
MVVYLIDASPKMFTPATKEREANKEMVVYLIDASPKMFTPATKEREANKEMVVYLIDASPKMFT PATKEREANKEMVVYLIDASPKMFTPATK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |