Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0612600_circ_g.2 |
ID in PlantcircBase | osa_circ_025198 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 31066054-31067432 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0612600 |
Parent gene annotation |
Similar to Coatomer-like protein, epsilon subunit. (Os04t0612600 -01);Similar to Coatomer-like protein, epsilon subunit. (Os04t06 12600-02) |
Parent gene strand | - |
Alternative splicing | Os04g0612600_circ_g.1 Os04g0612600_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0612600-01:4 Os04t0612600-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014776 |
PMCS | 0.27452978 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31067344-31067413(-) 31066134-31067397(-) |
Potential amino acid sequence |
MHEQDYTEALKHTHSGGTLDLHALNVQIFIKMHRSDYAEKQLKIMQQIDEDHTLTQLANAWLDI AVGGSKIREAYLIFQDFAEKYPMTGMVLNGKAVCCMHMGSFDEAETLLLEALNKDAKDPETLAN LIVCNLHLGKPSSRYLRKVRLSV*(-) MQKILKLLLILLCVISTLANRHQDTSGKCDCQSEGMVE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |