Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0825300_circ_g.2 |
ID in PlantcircBase | osa_circ_022518 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 34664235-34665365 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0825300 |
Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os03 t0825300-01);Serine/threonine protein kinase domain containing p rotein. (Os03t0825300-02);Serine/threonine protein kinase domain containing protein. (Os03t0825300-03) |
Parent gene strand | + |
Alternative splicing | Os03g0825300_circ_g.1 Os03g0825300_circ_g.3 Os03g0825300_circ_g.4 Os03g0825300_circ_g.5 Os03g0825300_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0825300-03:3 Os03t0825300-01:3 Os03t0825300-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.172582744 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34664654-34664602(+) 34664339-34664653(-) |
Potential amino acid sequence |
MPHETLAKHLFHWETKPLSWAMRVRAAFYVAQALEYCSSKGRALYHDLHAYRVLFDVRMAPPRT TAAACRCSPSTASTSYGWRPTGSLPSASCRSTARRRPTSSTAAPSSAPAAPWPSSASAALPGPT PASSWRRRGLSGSCGVSGWPT*(+) MRSGENPSVATRSSSRLYSANTGTPLPSSAAAPFSHQREPCMHADHGRELSLCYCSTPMPEPHR MQLVPSLPSSMALSPSGRDALPRSRAA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |